PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00784.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 254aa    MW: 28753.4 Da    PI: 7.6618
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00784.1_g00009.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.94.7e-083276446
                             S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                             WT+eE + + +a + ++ +   +W +Ia++++ g+t  ++   + k
  Rsa1.0_00784.1_g00009.1 32 WTKEENKMFERALAIYPEDspdRWFKIASMIP-GKTVFDVMKQYSK 76
                             ********************************.***9999888876 PP

2Myb_DNA-binding409.3e-13124168347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT+eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
  Rsa1.0_00784.1_g00009.1 124 PWTEEEHRRFLLGLLKYGKGDWRNISRNFVVSKTPTQVASHAQKY 168
                              8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.2832780IPR017884SANT domain
SMARTSM007177.9E-92880IPR001005SANT/Myb domain
SuperFamilySSF466891.45E-123085IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-43176IPR009057Homeodomain-like
PfamPF002499.6E-73276IPR001005SANT/Myb domain
CDDcd001671.35E-83277No hitNo description
PROSITE profilePS5129419.641117173IPR017930Myb domain
SuperFamilySSF466892.07E-15119172IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-17120172IPR006447Myb domain, plants
SMARTSM007171.7E-10121171IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-11121173IPR009057Homeodomain-like
CDDcd001673.91E-9124168No hitNo description
PfamPF002494.0E-10124168IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
METLNPLSHV PISDYRSVGQ DMVSLQSSSS IWTKEENKMF ERALAIYPED SPDRWFKIAS  60
MIPGKTVFDV MKQYSKLEED VFDIEEGRVP IPGYPSPLGF TQDTCRKRPN GARGSDHERK  120
KGVPWTEEEH RRFLLGLLKY GKGDWRNISR NFVVSKTPTQ VASHAQKYYQ RQLSGAKDKR  180
RPSIHDITTV NLLNANLNRS FSDHRDILPD LGFIENDKAE EGLMCMSQNL FSPSSAPFDA  240
AFNFAGVNAF SAGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-172299178RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00347DAPTransfer from AT3G11280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0561800.0AY056180.1 Arabidopsis thaliana putative MYB-family transcription factor (At3g11280) mRNA, complete cds.
GenBankAY0912650.0AY091265.1 Arabidopsis thaliana putative MYB-family transcription factor (At3g11280) mRNA, complete cds.
GenBankAY5503080.0AY550308.1 Arabidopsis thaliana MYB transcription factor (At3g11280) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009146740.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H74e-72DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A078EJT30.0A0A078EJT3_BRANA; BnaC05g41910D protein
STRINGBra034853.1-P1e-166(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43402657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.21e-157MYB family protein